PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G0178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 256aa    MW: 29078.7 Da    PI: 8.8322
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G0178genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-181764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+d+++++G g W+t +   g++R++k+c++rw +yl
      Gh_A08G0178 17 RGPWTAEEDKILIDYIQKHGHGKWRTLPTNAGLKRCGKSCRLRWANYL 64
                     89********************************************97 PP

2Myb_DNA-binding538.2e-1770113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w++
      Gh_A08G0178  70 RGKFSDEEEQTIIQLHSVLGNK-WSAIASRLP-GRTDNEIKNYWNT 113
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4091264IPR017930Myb domain
SuperFamilySSF466897.49E-3115111IPR009057Homeodomain-like
SMARTSM007172.7E-141666IPR001005SANT/Myb domain
PfamPF002492.5E-161764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-251871IPR009057Homeodomain-like
CDDcd001671.65E-111964No hitNo description
PROSITE profilePS5129426.19165119IPR017930Myb domain
SMARTSM007179.7E-1669117IPR001005SANT/Myb domain
PfamPF002491.1E-1570113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-2772119IPR009057Homeodomain-like
CDDcd001678.22E-1272113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGKQPACSSD KNGEFKRGPW TAEEDKILID YIQKHGHGKW RTLPTNAGLK RCGKSCRLRW  60
ANYLRPDIKR GKFSDEEEQT IIQLHSVLGN KWSAIASRLP GRTDNEIKNY WNTRIKKKLL  120
KMGIDPITHN PALHLLHLSS LLTSFLSNSY NLNNHPNKFL LGTESMSDPN FLIPVLSSSQ  180
NKNQLQNIEK NQAGNTFFQC PDNNQYEQGN QFQECDSKGF FPMQSYGYYD CNLSMDDQNQ  240
TCFSGNISSL GSFGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30171197108B-MYB
1h8a_C6e-301211922128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473143.11e-169PREDICTED: transcription repressor MYB6-like
RefseqXP_012473144.11e-169PREDICTED: transcription repressor MYB6-like
SwissprotQ8GWP03e-63MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2P5Z41e-169A0A0D2P5Z4_G
STRINGVIT_19s0014g03820.t014e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3606422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-72MYB-like 102